Search by Biz Keywords Browse Trade Leads within the marketplace. Or
Europe B2B Directory
European Companies
European Trade Leads
European Products

 Home   Browse by Country   Quick Search   Site Map   Terms of Service   Help

 Join Free   Login   Forgot Password?  Link to Us   Use our Content
Directory  My Trade Leads  Add Trade Lead  Send Targeted Trade Leads  Trade Alert  Trade Leads by Country

Trade Leads Directory -> All Trade Leads -> Chemicals -> Pharmaceutical Products -> GHRH 1-44
Europe.Bloombiz.com - View Trade Lead - GHRH 1-44
Promote your Business in Europe. Join FREE!   
Manufacturers  Distributors / Wholesalers  Trading Companies  Agents  Buying Offices  Importers / Exporters

GHRH 1-44 (Offer to Sell)

Peptide4u
 Top Member - Become a Top MemberRespond Online Now!
Get Contact Details Now!


Trade Lead Description:

Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Molecular Formula
C 215 H 358 N 72 O66 S

Molecular Weight
5039.76

Purity (HPLC)
95%

Description
A peptide of 44 amino acids in most species that stimulates the release and synthesis of GROWTH HORMONE. GHRF (or GRF) is synthesized by neurons in the ARCUATE NUCLEUS of the HYPOTHALAMUS. After being released into the pituitary portal circulation, GHRF stimulates GH release by the SOMATOTROPHS in the PITUITARY GLAND.
Type of Offer: Offer to Sell
Quantity: 1Gm
Packaging: 10mg
Price / Incoterms Conditions: Not Specified

Posted from China - Shanghai on 19 November, 2015
Contact Information

Join Now or Login
to contact Trade Lead Poster!

 
Company Details
Company Name: Peptide4u Top Member - Become a Top Member
Contact Person: George Lu
Location: China - Shanghai
Hotels in Shanghai, China
Companies from China
Trade Leads from China
Products from China
Classification: Chemicals - Pharmaceutical Products
Similar Trade Leads:
-->> More GHRH 1-44 Trade Leads
Related Site Sections:
* Company Directory: Chemicals - Pharmaceutical Products
* Biz Keywords: Chemicals - Pharmaceutical Products
* Product Showroom: Chemicals - Pharmaceutical Products
* Latest Business News
View More Trade Leads
Search For:

Europe.Bloombiz.com or and exact phrase
Contact Now!
Peptide4u
Top Member - Become a Top Member Member Website
21 Trade Leads posted
1 Product on sale
Members Login
 E-Mail Address:
 
 Password:
 
  Store my password
 Forgot password?
 Can't login?

 Not a member?
 Register for FREE!

Browse by Continent
Browse by Continent


What's New?

Europe B2B Portal Companies
Europe B2B Portal Products
Europe B2B Portal Trade Leads
Europe B2B Portal Buying Requests
Europe B2B Portal Selling Offers
Europe B2B Portal Opportunities
Popular Searches
pharmaceutical products buyers
vitamin buyers
b1 buyers
b2 buyers
b5 buyers
b12 buyers
c buyers
nicotinamide buyers
medicine buyers
veterinary products buyers
paracetamol buyers
Quick Links
  Home
  Browse by Country
  Browse Trade Leads
  Browse Companies
  Browse Products
  Top Products
  Top Searches
  Top Sites
  Browse Biz Keywords
  Partner / Trade Links
Advertisement



More Resources
Company Directory
Trade Lead Directory
Product Directory
Albania Companies, Business Directory
Andorra Companies, Business Directory
Armenia Companies, Business Directory
Austria Companies, Business Directory
Belarus Companies, Business Directory
Belgium Companies, Business Directory
Bosnia and Herzegovina Companies, Business Directory
Bulgaria Companies, Business Directory
Croatia Companies, Business Directory
Cyprus Companies, Business Directory
Czech Republic Companies, Business Directory
Denmark Companies, Business Directory
Estonia Companies, Business Directory
Finland Companies, Business Directory
France Companies, Business Directory
Germany Companies, Business Directory
Greece Companies, Business Directory
Hungary Companies, Business Directory
Iceland Companies, Business Directory
Ireland Companies, Business Directory
Israel Companies, Business Directory
Italy Companies, Business Directory
Liechtenstein Companies, Business Directory
Lithuania Companies, Business Directory
Luxembourg Companies, Business Directory
Macedonia Companies, Business Directory
Malta Companies, Business Directory
Moldova Companies, Business Directory
Monaco Companies, Business Directory
Netherlands Companies, Business Directory
Norway Companies, Business Directory
Poland Companies, Business Directory
Portugal Companies, Business Directory
Romania Companies, Business Directory
Russia Companies, Business Directory
Serbia and Montenegro Companies, Business Directory
Slovakia Companies, Business Directory
Slovenia Companies, Business Directory
Spain Companies, Business Directory
Sweden Companies, Business Directory
Switzerland Companies, Business Directory
Turkey Companies, Business Directory
UK Companies, Business Directory
Ukraine Companies, Business Directory
Vatican City Companies, Business Directory


Copyright 2003 - 2020 - Europe.Bloombiz.com
Top Searches | European Importers & Exporters | European Manufacturers | European Distributors | European Trading Companies
Top European Products | European Real Estate - Powered by www.tradeholding.com | About Us
Statistics: Companies: 641,100+, Trade Leads: 160,300+, Products: 104,200+, Contacts / Replies: 8,283,700+
There are currently 43417 users online browsing our B2B network. 22:10 GMT, Friday, December 27, 2024
Privacy Policy
Important Notice! TradeHolding.com B2B Network does not provide an escrow service! Any member who asks you to pay for their products by Western Union to an agent of "TradeHolding.com B2B Network" is fraud and should be immediately reported to us. Do not pay anything to any member who states your money will be added to TradeHolding.com safety deposit account!
All Trade Leads / Offers / Products / Company Profiles / Images and other user-posted contents are posted by the user and Europe.Bloombiz.com and TradeHolding.com B2B Network shall not be held liable for any such content. However, TradeHolding.com B2B Network respects the intellectual property, copyright, trademark, trade secret or any other personal or proprietary third party rights and expects the same from others. For concerns, please contact us.